PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK35417.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WRKY
Protein Properties Length: 274aa    MW: 31527.2 Da    PI: 8.4263
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK35417.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.71.8e-31126184159
                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 ldDgy+WrKYGqK+vk+s++pr+YYrCt+  C vkk+vers +dp+ v++tYeg+H+h+
  KFK35417.1 126 LDDGYKWRKYGQKPVKNSPYPRNYYRCTTDWCDVKKRVERSFSDPSSVITTYEGQHTHD 184
                 59********************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-32113185IPR003657WRKY domain
SuperFamilySSF1182901.1E-27121186IPR003657WRKY domain
PROSITE profilePS5081131.479121186IPR003657WRKY domain
SMARTSM007745.2E-37126185IPR003657WRKY domain
PfamPF031062.5E-24127184IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MENIDVGMPF CELGKTRAYS SFSDLSAERY PVGFMELLGV PQGISRYANM HLPATPNSSS  60
ILSTSREAEN GDEKKRDYEE DDEEEEEEEK QKSKRKRRVK STKSKDQTKI RVPKVSFITK  120
SVVDNLDDGY KWRKYGQKPV KNSPYPRNYY RCTTDWCDVK KRVERSFSDP SSVITTYEGQ  180
HTHDGPLITS KRRFGSNGSA SGPHFPSTLP PRFHQLFDYN NHQQQHPFPG TKLSHDDDHV  240
LKKSRTRDLL DGAGLIKEHG LLQDVVLYHI IKEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-261191861077Probable WRKY transcription factor 4
1wj2_A1e-261191861077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4211551e-57AF421155.1 Arabidopsis thaliana WRKY transcription factor 68 (WRKY68) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402383.11e-107hypothetical protein EUTSA_v10006458mg
SwissprotQ93WV62e-94WRK68_ARATH; Probable WRKY transcription factor 68
TrEMBLA0A087GZW50.0A0A087GZW5_ARAAL; Uncharacterized protein
STRINGBra007674.1-P1e-104(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM150681619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62340.12e-91WRKY family protein